Search Result
| Gene id | 22932 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | POMZP3 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | POM-ZP3, POM121 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | POM121 and ZP3 fusion | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | POM121 and ZP3 fusion protein, POM (POM121 homolog, rat) and ZP3 fusion, POM (POM121 rat homolog) and ZP3 fusion, POM-ZP3 fusion protein, POM121/ZP3 fusion protein, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
7q11.23 (159904755: 159803354) Exons: 35 NC_000002.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3' exons from the ZP3 gene. The 5' end of this gene is similar to the |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 600587 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q6PJE2 Name: POM121 and ZP3 fusion protein (POM ZP3) Length: 187 Mass: 20620 Tissue specificity: Expressed in spleen, thymus, pancreas, testis, ovary, small intestine, colon and lymphocytes. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MVCSPVTLRIAPPDRRFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKKKKRTVEEEDQIFLDGQENKR SCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPV EGLADICQCCNKGDCGTPSHSRRQPRVVSQWSTSASL | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: POMZP3  Malacards: POMZP3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||