• Gene id: 22859

Gene Summary

• Gene Symbol: ADGRL1   Gene   UCSC   Ensembl
• Aliases: CIRL1, CL1, LEC2, LPHN1
• Gene name: adhesion G protein-coupled receptor L1
• Alternate names: adhesion G protein-coupled receptor L1, CIRL-1, calcium-independent alpha-latrotoxin receptor 1, latrophilin-1, lectomedin-2,
• Gene location: 19p13.12 (14206244: 14147736)     Exons: 27     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the latrophilin subfamily of G-protein coupled receptors (GPCR). Latrophilins may function in both cell adhesion and signal transduction. In experiments with non-human species, endogenous proteolytic cleavage within a cystein
• OMIM: 616416

Protein Summary

• Protein general information: O94910  
  • Name: Adhesion G protein coupled receptor L1 (Calcium independent alpha latrotoxin receptor 1) (CIRL 1) (Latrophilin 1) (Lectomedin 2)
  • Length: 1474  
  • Mass: 162717
• Sequence:

  MARLAAVLWNLCVTAVLVTSATQGLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVENANYGRTDDKICDADP
  FQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYKYLEVQYDCVPYKVEQKVFVCPGTLQKVLEP
  TSTHESEHQSGAWCKDPLQAGDRIYVMPWIPYRTDTLTEYASWEDYVAARHTTTYRLPNRVDGTGFVVYDGAVFY
  NKERTRNIVKYDLRTRIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEGNNGRLVVSQLNPYTL
  RFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNTNANREEPVSLTFPNPYQFISSVDYN
  PRDNQLYVWNNYFVVRYSLEFGPPDPSAGPATSPPLSTTTTARPTPLTSTASPAATTPLRRAPLTTHPVGAINQL
  GPDLPPATAPVPSTRRPPAPNLHVSPELFCEPREVRRVQWPATQQGMLVERPCPKGTRGIASFQCLPALGLWNPR
  GPDLSNCTSPWVNQVAQKIKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAG
  KNYNKMHKRERTCKDYIKAVVETVDNLLRPEALESWKDMNATEQVHTATMLLDVLEEGAFLLADNVREPARFLAA
  KENVVLEVTVLNTEGQVQELVFPQEEYPRKNSIQLSAKTIKQNSRNGVVKVVFILYNNLGLFLSTENATVKLAGE
  AGPGGPGGASLVVNSQVIAASINKESSRVFLMDPVIFTVAHLEDKNHFNANCSFWNYSERSMLGYWSTQGCRLVE
  SNKTHTTCACSHLTNFAVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLC
  INLFLAELLFLVGIDKTQYEIACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYSRTKYYYLGGYCFPA
  LVVGIAAAIDYRSYGTEKACWLRVDNYFIWSFIGPVSFVIVVNLVFLMVTLHKMIRSSSVLKPDSSRLDNIKSWA
  LGAIALLFLLGLTWAFGLLFINKESVVMAYLFTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIRSPPGG
  THGSLKTSAMRSNTRYYTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNHLLTNPVLQPRGGTSPY
  NTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLPLNGNFNNSYSLRSGDFPPGDGGPEPPRGRNLA
  DAAAFEKMIISELVHNNLRGSSSAAKGPPPPEPPVPPVPGGGGEEEAGGPGGADRAEIELLYKALEEPLLLPRAQ
  SVLYQSDLDESESCTAEDGATSRPLSSPPGRDSLYASGANLRDSPSYPDSSPEGPSEALPPPPPAPPGPPEIYYT
  SRPPALVARNPLQGYYQVRRPSHEGYLAAPGLEGPGPDGDGQMQLVTSL

• Structural information:
  • Protein Domains: (40..12-)
    (/note="SUEL-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00260-)
    (139..39-)
    (/note="Olfactomedin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00446-)
    (799..85-)
    (/note="GPS-)
    (/evidence="ECO:0000255|PROSITE-Pr-)
  • Interpro: IPR032471  IPR017981  IPR036445  IPR001879  IPR003924   IPR003334  IPR000832  IPR017983  IPR000203  IPR031234  IPR000922  IPR003112  
  • Prosite: PS00650 PS50227 PS50261 PS50221 PS51132 PS50228
  • STRING: ENSP00000340688
• Other Databases: GeneCards:  ADGRL1  Malacards:  ADGRL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0016524	latrotoxin receptor activity	IBA	molecular function
GO:0030424	axon	IBA	cellular component
GO:0042734	presynaptic membrane	IBA	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0042734	presynaptic membrane	ISS	cellular component
GO:0035584	calcium-mediated signaling using intracellular calcium source	ISS	biological process
GO:0030424	axon	ISS	cellular component
GO:0016524	latrotoxin receptor activity	ISS	molecular function
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process
GO:0090129	positive regulation of synapse maturation	ISS	biological process
GO:0050839	cell adhesion molecule binding	ISS	molecular function
GO:0045202	synapse	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0042734	presynaptic membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray