• Gene id: 22854

Gene Summary

• Gene Symbol: NTNG1   Gene   UCSC   Ensembl
• Aliases: Lmnt1
• Gene name: netrin G1
• Alternate names: netrin-G1, axon guidance molecule, laminet 1,
• Gene location: 1p13.3 (24284189: 24291861)     Exons: 4     NC_000007.14
• Gene summary(Entrez): This gene encodes a preproprotein that is processed into a secreted protein containing eukaroytic growth factor (EGF)-like domains. This protein acts to guide axon growth during neuronal development. Polymorphisms in this gene may be associated with schiz
• OMIM: 608818

Protein Summary

• Protein general information: Q9Y2I2  
  • Name: Netrin G1 (Laminet 1)
  • Length: 539  
  • Mass: 60541
  • Tissue specificity: Highly expressed in the thalamus, with very low expression, if any, in other tissues. {ECO
• Sequence:

  MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKYLKVKLDPPDITCGDP
  PETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKTIELTDNIVI
  TFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEI
  KDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
  LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISSIGNCECFGHSNRCSY
  IDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECKTGTTGPKCD
  ECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALL
  LLTTLLGTASPLVF

• Structural information:
  • Protein Domains: (46..29-)
    (/note="Laminin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00466-)
    (297..35-)
    1 (/note="Laminin-EGF-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00460-)
    (364..41-)
    2 (/note="Laminin-EGF-like)
    (/evidence="ECO:-)
  • Interpro: IPR013032  IPR000742  IPR002049  IPR008211  IPR038684  
  • Prosite: PS00022 PS50026 PS01248 PS50027 PS51117
  • PDB: 3ZYJ
  • PDBsum: 3ZYJ
  • STRING: ENSP00000359085
• Other Databases: GeneCards:  NTNG1  Malacards:  NTNG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0099560	synaptic membrane adhesion	IGI	biological process
GO:0098632	cell-cell adhesion mediator activity	IGI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0098632	cell-cell adhesion mediator activity	IBA	molecular function
GO:0009888	tissue development	IBA	biological process
GO:0010975	regulation of neuron projection development	ISS	biological process
GO:0150011	regulation of neuron projection arborization	ISS	biological process
GO:2001222	regulation of neuron migration	ISS	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007409	axonogenesis	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0099029	anchored component of presynaptic active zone membrane	IEA	cellular component
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0046658	anchored component of plasma membrane	ISS	cellular component
GO:0007409	axonogenesis	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray