• Gene id: 2267

Gene Summary

• Gene Symbol: FGL1   Gene   UCSC   Ensembl
• Aliases: HFREP1, HP-041, HPS, LFIRE-1, LFIRE1
• Gene name: fibrinogen like 1
• Alternate names: fibrinogen-like protein 1, hepassocin, hepatocellular carcinoma-related sequence, hepatocyte-derived fibrinogen-related protein 1, liver fibrinogen-related protein 1,
• Gene location: 8p22 (17909982: 17864379)     Exons: 11     NC_000008.11
• Gene summary(Entrez): Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, thi
• OMIM: 605776

Protein Summary

• Protein general information: Q08830  
  • Name: Fibrinogen like protein 1 (HP 041) (Hepassocin) (HPS) (Hepatocyte derived fibrinogen related protein 1) (HFREP 1) (Liver fibrinogen related protein 1) (LFIRE 1)
  • Length: 312  
  • Mass: 36379
  • Tissue specificity: Under normal conditions, liver-specific. {ECO
• Sequence:

  MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLG
  SKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQK
  HGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQW
  WASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVM
  KIRPNDFIPNVI

• Structural information:
  • Protein Domains: (74..30-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR036056  IPR002181  IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • STRING: ENSP00000381133
• Other Databases: GeneCards:  FGL1  Malacards:  FGL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0050776	regulation of immune response	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0050868	negative regulation of T cell activation	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0072574	hepatocyte proliferation	IDA	biological process
GO:0050776	regulation of immune response	ISS	biological process
GO:0050868	negative regulation of T cell activation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005577	fibrinogen complex	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R