• Gene id: 222658

Gene Summary

• Gene Symbol: KCTD20   Gene   UCSC   Ensembl
• Aliases: C6orf69, dJ108K11.3
• Gene name: potassium channel tetramerization domain containing 20
• Alternate names: BTB/POZ domain-containing protein KCTD20, potassium channel tetramerisation domain containing 20,
• Gene location: 6p21.31 (36442766: 36491142)     Exons: 11     NC_000006.12
• OMIM: 300026

Protein Summary

• Protein general information: Q7Z5Y7  
  • Name: BTB/POZ domain containing protein KCTD20 (Potassium channel tetramerization domain containing 20)
  • Length: 419  
  • Mass: 47480
• Sequence:

  MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYASQPANLQFPHIMPLA
  EDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTMLGRMFGPG
  REYNFTRPNEKGEYEIAEGISATVFRTVLDYYKTGIINCPDGISIPDLRDTCDYLCINFDFNTIRCQDLSALLHE
  LSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMGEEYSQILYSSKLYRFFKYIE
  NRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPFIQMSWEKEEGKSRHVDFQCVRSKSL
  TNLVAAGDDVLEDQEILMHHPPQVDELDRLNAPLSQMASNDFQD

• Structural information:
  • Protein Domains: (117..19-)
    (/note="BTB"-)
  • Interpro: IPR000210  IPR039886  IPR039885  IPR011333  
  • STRING: ENSP00000362836
• Other Databases: GeneCards:  KCTD20  Malacards:  KCTD20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042327	positive regulation of phosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0042327	positive regulation of phosphorylation	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042327	positive regulation of phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0042327	positive regulation of phosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0042327	positive regulation of phosphorylation	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042327	positive regulation of phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq