• Gene id: 222553

Gene Summary

• Gene Symbol: SLC35F1   Gene   UCSC   Ensembl
• Aliases: C6orf169, dJ230I3.1
• Gene name: solute carrier family 35 member F1
• Alternate names: solute carrier family 35 member F1,
• Gene location: 6q22.2-q22.31 (169010283: 168894483)     Exons: 10     NC_000004.12

Protein Summary

• Protein general information: Q5T1Q4  
  • Name: Solute carrier family 35 member F1
  • Length: 408  
  • Mass: 45346
• Sequence:

  MIPPEQPQQQLQPPSPAPPNHVVTTIENLPAEGSGGGGSLSASSRAGVRQRIRKVLNREMLISVALGQVLSLLIC
  GIGLTSKYLSEDFHANTPVFQSFLNYILLFLVYTTTLAVRQGEENLLAILRRRWWKYMILGLIDLEANYLVVKAY
  QYTTLTSIQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQGAGENKLVGDLLVLG
  GATLYGISNVWEEYIIRTLSRVEFLGMIGLFGAFFSGIQLAIMEHKELLKVPWDWQIGLLYVGFSACMFGLYSFM
  PVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYKFSGLYLLSFFTILIGLVLYSSTSTYIAQDPRVYKQFRNPSG
  PVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA

• Structural information:
  • Interpro: IPR009262  
  • STRING: ENSP00000353557
• Other Databases: GeneCards:  SLC35F1  Malacards:  SLC35F1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)