• Gene id: 222487

Gene Summary

• Gene Symbol: ADGRG3   Gene   UCSC   Ensembl
• Aliases: GPR97, PB99, PGR26
• Gene name: adhesion G protein-coupled receptor G3
• Alternate names: adhesion G protein-coupled receptor G3, G protein-coupled receptor 97, G-protein coupled receptor PGR26, probable G-protein coupled receptor 97,
• Gene location: 16q21 (57663997: 57689377)     Exons: 13     NC_000016.10

Protein Summary

• Protein general information: Q86Y34  
  • Name: Adhesion G protein coupled receptor G3 (G protein coupled receptor 97) (G protein coupled receptor PGR26)
  • Length: 549  
  • Mass: 60861
  • Tissue specificity: Expressed in cultured primary dermal lymphatic endothelial cells. {ECO
• Sequence:

  MATPRGLGALLLLLLLPTSGQEKPTEGPRNTCLGSNNMYDIFNLNDKALCFTKCRQSGSDSCNVENLQRYWLNYE
  AHLMKEGLTQKVNTPFLKALVQNLSTNTAEDFYFSLEPSQVPRQVMKDEDKPPDRVRLPKSLFRSLPGNRSVVRL
  AVTILDIGPGTLFKGPRLGLGDGSGVLNNRLVGLSVGQMHVTKLAEPLEIVFSHQRPPPNMTLTCVFWDVTKGTT
  GDWSSEGCSTEVRPEGTVCCCDHLTFFALLLRPTLDQSTVHILTRISQAGCGVSMIFLAFTIILYAFLRLSRERF
  KSEDAPKIHVALGGSLFLLNLAFLVNVGSGSKGSDAACWARGAVFHYFLLCAFTWMGLEAFHLYLLAVRVFNTYF
  GHYFLKLSLVGWGLPALMVIGTGSANSYGLYTIRDRENRTSLELCWFREGTTMYALYITVHGYFLITFLFGMVVL
  ALVVWKIFTLSRATAVKERGKNRKKVLTLLGLSSLVGVTWGLAIFTPLGLSTVYIFALFNSLQGVFICCWFTILY
  LPSQSTTVSSSTARLDQAHSASQE

• Structural information:
  • Protein Domains: (212..26-)
    (/note="GPS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00098"-)
  • Interpro: IPR017981  IPR000832  IPR003910  IPR000203  
  • Prosite: PS50261 PS50221
  • STRING: ENSP00000332900
• Other Databases: GeneCards:  ADGRG3  Malacards:  ADGRG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0030334	regulation of cell migration	IMP	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0032792	negative regulation of CREB transcription factor activity	ISS	biological process
GO:1901223	negative regulation of NIK/NF-kappaB signaling	ISS	biological process
GO:0005886	plasma membrane	IMP	cellular component
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032792	negative regulation of CREB transcription factor activity	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq