• Gene id: 222236

Gene Summary

• Gene Symbol: NAPEPLD   Gene   UCSC   Ensembl
• Aliases: C7orf18, FMP30, NAPE-PLD
• Gene name: N-acyl phosphatidylethanolamine phospholipase D
• Alternate names: N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, NAPE-hydrolyzing phospholipase D,
• Gene location: 7q22.1 (103149559: 103099575)     Exons: 8     NC_000007.14
• Gene summary(Entrez): NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]).[supplied by
• OMIM: 612334

Protein Summary

• Protein general information: Q6IQ20  
  • Name: N acyl phosphatidylethanolamine hydrolyzing phospholipase D (N acyl phosphatidylethanolamine phospholipase D) (NAPE PLD) (NAPE hydrolyzing phospholipase D) (EC 3.1.4.54)
  • Length: 393  
  • Mass: 45596
  • Tissue specificity: Widely expressed. Highest expression in brain, kidney and testis (at protein level). Expressed in adipose tissue (at protein level). {ECO
• Sequence:

  MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNP
  SIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIF
  SSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCE
  NVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGP
  FDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDF
  FVLKHGESRYLNNDDENF

• Structural information:
  • Interpro: IPR001279  IPR024884  IPR036866  
  • PDB: 4QN9
  • PDBsum: 4QN9
  • DIP: 61398
  • STRING: ENSP00000407112
• Other Databases: GeneCards:  NAPEPLD  Malacards:  NAPEPLD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0070290	N-acylphosphatidylethanolamine-specific phospholipase D activity	IBA	molecular function
GO:0070291	N-acylethanolamine metabolic process	IBA	biological process
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IBA	biological process
GO:0043227	membrane-bounded organelle	IBA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0008270	zinc ion binding	IDA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IDA	biological process
GO:0070290	N-acylphosphatidylethanolamine-specific phospholipase D activity	IDA	molecular function
GO:0090336	positive regulation of brown fat cell differentiation	ISS	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0048874	host-mediated regulation of intestinal microbiota composition	ISS	biological process
GO:0005654	nucleoplasm	ISS	cellular component
GO:0001659	temperature homeostasis	ISS	biological process
GO:0005769	early endosome	ISS	cellular component
GO:0005635	nuclear envelope	ISS	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0070290	N-acylphosphatidylethanolamine-specific phospholipase D activity	IEA	molecular function
GO:0009395	phospholipid catabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0102200	N-acetylphosphatidylethanolamine-hydrolysing phospholipase activity	IEA	molecular function
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0042622	photoreceptor outer segment membrane	TAS	cellular component
GO:0070290	N-acylphosphatidylethanolamine-specific phospholipase D activity	TAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0035900	response to isolation stress	IEA	biological process
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IEA	biological process
GO:0070291	N-acylethanolamine metabolic process	IEA	biological process
GO:0070290	N-acylphosphatidylethanolamine-specific phospholipase D activity	IEA	molecular function
GO:0001659	temperature homeostasis	IEA	biological process
GO:1903999	negative regulation of eating behavior	IEA	biological process
GO:0043227	membrane-bounded organelle	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004620	phospholipase activity	IEA	molecular function
GO:0090336	positive regulation of brown fat cell differentiation	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0048874	host-mediated regulation of intestinal microbiota composition	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04723	Retrograde endocannabinoid signaling

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881