• Gene id: 221908

Gene Summary

• Gene Symbol: PPP1R35   Gene   UCSC   Ensembl
• Aliases: C7orf47
• Gene name: protein phosphatase 1 regulatory subunit 35
• Alternate names: protein phosphatase 1 regulatory subunit 35, UPF0683 protein C7orf47,
• Gene location: 7q22.1 (40161068: 40221122)     Exons: 23     NC_000015.10

Protein Summary

• Protein general information: Q8TAP8  
  • Name: Protein phosphatase 1 regulatory subunit 35
  • Length: 253  
  • Mass: 27953
• Sequence:

  MMMGCGESELKSADGEEAAAVPGPPPEPQVPQLRAPVPEPGLDLSLSPRPDSPQPRHGSPGRRKGRAERRGAARQ
  RRQVRFRLTPPSPVRSEPQPAVPQELEMPVLKSSLALGLELRAAAGSHFDAAKAVEEQLRKSFQIRCGLEESVSE
  GLNVPRSKRLFRDLVSLQVPEEQVLNAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDG
  LPPLRLQLRPRPSEDTFLMHRTLRRWEA

• Structural information:
  • Interpro: IPR033590  IPR029135  
  • STRING: ENSP00000292330
• Other Databases: GeneCards:  PPP1R35  Malacards:  PPP1R35

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010923	negative regulation of phosphatase activity	IBA	biological process
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0010923	negative regulation of phosphatase activity	IEA	biological process
GO:0019902	phosphatase binding	IEA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray