Search Result
| Gene id | 2215 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | FCGR3B Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CD16, CD16A, CD16b, FCG3, FCGR3, FCGR3A, FCR-10, FCRIII, FCRIIIb | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | Fc fragment of IgG receptor IIIb | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | low affinity immunoglobulin gamma Fc region receptor III-B, Fc fragment of IgG, low affinity IIIb, receptor (CD16b), Fc gamma receptor III-B, Fc gamma receptor IIIb, Fc-gamma receptor IIIb (CD 16), fc-gamma RIII-beta, fc-gamma RIIIb, igG Fc receptor III-1, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
1q23.3 (161631962: 161623195) Exons: 7 NC_000001.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 610665 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | O75015 Name: Low affinity immunoglobulin gamma Fc region receptor III B (Fc gamma RIII beta) (Fc gamma RIII) (Fc gamma RIIIb) (FcRIII) (FcRIIIb) (FcR 10) (IgG Fc receptor III 1) (CD antigen CD16b) Length: 233 Mass: 26216 Tissue specificity: Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYF IDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKY FHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGL YFSVKTNI | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: FCGR3B  Malacards: FCGR3B | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||