• Gene id: 221491

Gene Summary

• Gene Symbol: SMIM29   Gene   UCSC   Ensembl
• Aliases: C6orf1, LBH
• Gene name: small integral membrane protein 29
• Alternate names: small integral membrane protein 29, uncharacterized protein C6orf1,
• Gene location: 6p21.31 (34249107: 34246379)     Exons: 5     NC_000006.12

Protein Summary

• Protein general information: Q86T20  
  • Name: Small integral membrane protein 29 (Protein LBH)
  • Length: 102  
  • Mass: 11550
  • Tissue specificity: Expressed in spleen, thymus, prostate, testis, uterus, small intestine, colon and peripheral blood leukocytes. {ECO
• Sequence:

  MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLPMYSYDPAEELHEAEQELLS
  DMGDPKVVHGWQSGYQHKRMPLLDVKT

• Structural information:
  • STRING: ENSP00000417604
• Other Databases: GeneCards:  SMIM29  Malacards:  SMIM29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881