• Gene id: 221302

Gene Summary

• Gene Symbol: ZUP1   Gene   UCSC   Ensembl
• Aliases: C6orf113, DUB, ZUFSP
• Gene name: zinc finger containing ubiquitin peptidase 1
• Alternate names: zinc finger-containing ubiquitin peptidase 1, lys-63-specific deubiquitinase ZUFSP, ubiquitin carboxyl-terminal hydrolase ZUFSP, zinc finger with UFM1-specific peptidase domain protein,
• Gene location: 6q22.1 (116668809: 116635617)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein containing zinc finger motifs and a cysteine peptidase domain. The encoded protein functions as a K63-specific de-ubiquitinating enzyme that specifically cleaves long K63-linked polyubiquitin chains in the middle of a chain (i.

Protein Summary

• Protein general information: Q96AP4  
  • Name: Zinc finger containing ubiquitin peptidase 1 (EC 3.4.19.12) (Lys 63 specific deubiquitinase ZUFSP) (DUB) (Zinc finger with UFM1 specific peptidase domain protein)
  • Length: 578  
  • Mass: 65959
• Sequence:

  MLSCNICGETVTSEPDMKAHLIVHMESEIICPFCKLSGVNYDEMCFHIETAHFEQNTLERNFERINTVQYGTSDN
  KKDNTLQCGMEVNSSILSGCASNHPKNSAQNLTKDSTLKHEGFYSENLTESRKFLKSREKQSSLTEIKGSVYETT
  YSPPECPFCGKIEEHSEDMETHVKTKHANLLDIPLEDCDQPLYDCPMCGLICTNYHILQEHVDLHLEENSFQQGM
  DRVQCSGDLQLAHQLQQEEDRKRRSEESRQEIEEFQKLQRQYGLDNSGGYKQQQLRNMEIEVNRGRMPPSEFHRR
  KADMMESLALGFDDGKTKTSGIIEALHRYYQNAATDVRRVWLSSVVDHFHSSLGDKGWGCGYRNFQMLLSSLLQN
  DAYNDCLKGMLIPCIPKIQSMIEDAWKEGFDPQGASQLNNRLQGTKAWIGACEVYILLTSLRVKCHIVDFHKSTG
  PLGTHPRLFEWILNYYSSEGEGSPKVVCTSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLK
  QDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTAEKIP

• Structural information:
  • Interpro: IPR012462  IPR013087  
  • Prosite: PS00028 PS50157
  • PDB: 6EI1 6FGE
  • PDBsum: 6EI1 6FGE
  • STRING: ENSP00000357565
• Other Databases: GeneCards:  ZUP1  Malacards:  ZUP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881