• Gene id: 221301

Gene Summary

• Gene Symbol: CALHM4   Gene   UCSC   Ensembl
• Aliases: C6orf78, FAM26D
• Gene name: calcium homeostasis modulator family member 4
• Alternate names: calcium homeostasis modulator protein 4, family with sequence similarity 26 member D, protein FAM26D,
• Gene location: 6q22.1 (116529020: 116561126)     Exons: 8     NC_000006.12
• OMIM: 612848

Protein Summary

• Protein general information: Q5JW98  
  • Name: Calcium homeostasis modulator protein 4 (Protein FAM26D)
  • Length: 314  
  • Mass: 35060
• Sequence:

  MCPTLNNIVSSLQRNGIFINSLIAALTIGGQQLFSSSTFSCPCQVGKNFYYGSAFLVIPALILLVAGFALRSQMW
  TITGEYCCSCAPPYRRISPLECKLACLRFFSITGRAVIAPLTWLAVTLLTGTYYECAASEFASVDHYPMFDNVSA
  SKREEILAGFPCCRSAPSDVILVRDEIALLHRYQSQMLGWILITLATIAALVSCCVAKCCSPLTSLQHCYWTSHL
  QNERELFEQAAEQHSRLLMMHRIKKLFGFIPGSEDVKHIRIPSCQDWKDISVPTLLCMGDDLQGHYSFLGNRVDE
  DNEEDRSRGIELKP

• Structural information:
  • Interpro: IPR029569  IPR029574  
  • STRING: ENSP00000385836
• Other Databases: GeneCards:  CALHM4  Malacards:  CALHM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005261	cation channel activity	IBA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray