• Gene id: 2212

Gene Summary

• Gene Symbol: FCGR2A   Gene   UCSC   Ensembl
• Aliases: CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, FcGR, IGFR2
• Gene name: Fc fragment of IgG receptor IIa
• Alternate names: low affinity immunoglobulin gamma Fc region receptor II-a, Fc fragment of IgG, low affinity IIa, receptor (CD32), Fc gamma receptor RIIa3, Immunoglobulin G Fc receptor II, fc-gamma-RIIa, fcRII-a, igG Fc receptor II-a,
• Gene location: 1q23.3 (161505429: 161524047)     Exons: 12     NC_000001.11
• Gene summary(Entrez): This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and
• OMIM: 603659

Protein Summary

• Protein general information: P12318  
  • Name: Low affinity immunoglobulin gamma Fc region receptor II a (IgG Fc receptor II a) (CDw32) (Fc gamma RII a) (Fc gamma RIIa) (FcRII a) (CD antigen CD32)
  • Length: 317  
  • Mass: 35001
  • Tissue specificity: Found on monocytes, neutrophils and eosinophil platelets.
• Sequence:

  MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQW
  FHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKP
  LVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIA
  TAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD
  KNIYLTLPPNDHVNSNN

• Structural information:
  • Protein Domains: (39..11-)
    1 (/note="Ig-like-C2-type)
    (122..20-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
  • Prosite: PS50835
  • PDB: 1FCG 1H9V 3D5O 3RY4 3RY5 3RY6
  • PDBsum: 1FCG 1H9V 3D5O 3RY4 3RY5 3RY6
  • STRING: ENSP00000271450
• Other Databases: GeneCards:  FCGR2A  Malacards:  FCGR2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0050776	regulation of immune response	IBA	biological process
GO:0019864	IgG binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04380	Osteoclast differentiation
hsa05322	Systemic lupus erythematosus
hsa04611	Platelet activation
hsa04666	Fc gamma R-mediated phagocytosis
hsa05150	Staphylococcus aureus infection
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Allergic rhinitis	KEGG:H01360
Systemic lupus erythematosus	KEGG:H00080
Allergic rhinitis	KEGG:H01360
Systemic lupus erythematosus	KEGG:H00080
diffuse large B-cell lymphoma	PMID:27282998
Non-Hodgkin lymphoma	PMID:25850245
Thrombosis	PMID:18983497
Lupus nephritis	PMID:15004265
Lymphocytic leukemia	PMID:20705761
Visual epilepsy	PMID:17596285
factor VIII deficiency	PMID:24916518
common variable immunodeficiency	PMID:17900300
neutropenia	PMID:11295474
Temporal arteritis	PMID:16846526
Arthus reaction	PMID:10762218
Respiratory system disease	PMID:16550341
Diffuse scleroderma	PMID:8254199
Thrombocytopenia	PMID:10201963
Atherosclerosis	PMID:19490059
Asthma	PMID:9117017
Atopic dermatitis	PMID:7564170
Coronary artery disease	PMID:20973705
Hemolytic anemia	PMID:15982355
Lymphopenia	PMID:17596285
Rheumatoid arthritis	PMID:8254199
Rheumatoid arthritis	PMID:12508778
Osteoarthritis	PMID:8254199
chronic myeloid leukemia	PMID:8632671
Crohn's disease	PMID:20848524
Psoriasis	PMID:20471070
Autoimmune thrombocytopenic purpura	PMID:21131591
Autoimmune thrombocytopenic purpura	PMID:22123287
Systemic lupus erythematosus	PMID:14747618
Systemic lupus erythematosus	PMID:8254199
multiple myeloma	PMID:25850245
multiple myeloma	PMID:17315188
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881