• Gene id: 219902

Gene Summary

• Gene Symbol: TLCD5   Gene   UCSC   Ensembl
• Aliases: TMEM136
• Gene name: TLC domain containing 5
• Alternate names: TLC domain-containing protein 5, transmembrane protein 136,
• Gene location: 11q23.3 (120325298: 120333685)     Exons: 4     NC_000011.10

Protein Summary

• Protein general information: Q6ZRR5  
  • Name: TLC domain containing protein 5 (Transmembrane protein 136)
  • Length: 245  
  • Mass: 27859
• Sequence:

  MALALCLQVLCSLCGWLSLYISFCHLNKHRSYEWSCRLVTFTHGVLSIGLSAYIGFIDGPWPFTHPGSPNTPLQV
  HVLCLTLGYFIFDLGWCVYFQSEGALMLAHHTLSILGIIMALVLGESGTEVNAVLFGSELTNPLLQMRWFLRETG
  HYHSFTGDVVDFLFVALFTGVRIGVGACLLFCEMVSPTPKWFVKAGGVAMYAVSWCFMFSIWRFAWRKSIKKYHA
  WRSRRSEERQLKHNGHLKIH

• Structural information:
  • Protein Domains: (29..20-)
    (/note="TLC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00205"-)
  • Interpro: IPR006634  IPR042512  
  • Prosite: PS50922
  • STRING: ENSP00000312672
• Other Databases: GeneCards:  TLCD5  Malacards:  TLCD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881