Search Result
| Gene id | 219793 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | TBATA Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | C10orf27, SPATIAL | ||||||||||||||||||||||||||||||||||||
| Gene name | thymus, brain and testes associated | ||||||||||||||||||||||||||||||||||||
| Alternate names | protein TBATA, stromal protein associated with thymii and lymph node homolog, thymus, brain and testes-associated protein, | ||||||||||||||||||||||||||||||||||||
| Gene location |
10q22.1 (70785400: 70771236) Exons: 5 NC_000010.11 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein that regulates thymic epithelial cell proliferation and thymus size. It has been identified as a ligand for the class I human leukocyte antigen (HLA-I) in thymus. Studies of the orthologous mouse protein suggest that it may als |
||||||||||||||||||||||||||||||||||||
| OMIM | 612640 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q96M53 Name: Protein TBATA (Protein SPATIAL) (Stromal protein associated with thymii and lymph node homolog) (Thymus, brain and testes associated protein) Length: 351 Mass: 39460 | ||||||||||||||||||||||||||||||||||||
| Sequence |
MATDVQLADYPLMSPKAELKLEKKSGRKPRSPRDSGPQKELVIPGIVDFERIRRALRTPKPQTPGTYCFGRLSHH SFFSRHHPHPQHVTHIQDLTGKPVCVVRDFPAPLPESTVFSGCQMGIPTISVPIGDPQSNRNPQLSSEAWKKELK ELASRVAFLTKEDELKKKEKEQKEEPLREQGAKYSAETGRLIPASTRAVGRRRSHQGQQSQSSSRHEGVQAFLLQ DQELLVLELLCRILETDLLSAIQFWLLYAPPKEKDLALGLLQTAVAQLLPQPLVSIPTEKLLSQLPEVHEPPQEK QEPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: TBATA  Malacards: TBATA | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||