Search Result
| Gene id | 219670 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | ENKUR Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | C10orf63, CFAP106 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | enkurin, TRPC channel interacting protein | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | enkurin, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
10p12.1 (25062278: 24981978) Exons: 9 NC_000010.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein that interacts with calmodulin and several transient receptor potential canonical cation channel proteins. The encoded protein may function as an adaptor to localize signal transduction machinery to calcium channels. Alternativ |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 602003 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8TC29 Name: Enkurin Length: 256 Mass: 29454 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEKTLPPK KNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKD YGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKI RKQRLEEEMKQLEHDIGIIEKHKIIYIANNA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: ENKUR  Malacards: ENKUR | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||