• Gene id: 219541

Gene Summary

• Gene Symbol: MED19   Gene   UCSC   Ensembl
• Aliases: DT2P1G7, LCMR1, MED19AS
• Gene name: mediator complex subunit 19
• Alternate names: mediator of RNA polymerase II transcription subunit 19, lung cancer metastasis-related protein 1, mediator of RNA polymerase II transcription, subunit 19 homolog, putative mediator subunit MED19AS protein,
• Gene location: 11q12.1 (57712322: 57703708)     Exons: 5     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a subunit of the Mediator complex, which binds to gene-specific regulatory factors and provides support for the basal RNA polymerase II transcription machinery. This gene has been implicated in the growth of several typ

Protein Summary

• Protein general information: A0JLT2  
  • Name: Mediator of RNA polymerase II transcription subunit 19 (Lung cancer metastasis related protein 1) (Mediator complex subunit 19)
  • Length: 244  
  • Mass: 26273
• Sequence:

  MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGST
  ELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLA
  GFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRH
  SPDHPGMGSSQASSSSSLR

• Structural information:
  • Interpro: IPR019403  
  • DIP: 31467
  • STRING: ENSP00000337340
• Other Databases: GeneCards:  MED19  Malacards:  MED19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016592	mediator complex	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016592	mediator complex	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray