• Gene id: 2124

Gene Summary

• Gene Symbol: EVI2B   Gene   UCSC   Ensembl
• Aliases: CD361, D17S376, EVDB
• Gene name: ecotropic viral integration site 2B
• Alternate names: protein EVI2B, EVI-2B, ecotropic viral integration site 2B protein homolog,
• Gene location: 17q11.2 (31314148: 31303769)     Exons: 3     NC_000017.11
• OMIM: 610895

Protein Summary

• Protein general information: P34910  
  • Name: Protein EVI2B (Ecotropic viral integration site 2B protein homolog) (EVI 2B) (CD antigen CD361)
  • Length: 448  
  • Mass: 48666
  • Tissue specificity: Bone marrow, peripheral blood mononuclear cells, fibroblasts and Epstein-Barr virus-transformed lymphoblastoid cell lines. Strongly expressed in granulocytic cells, and weakly on lymphocytes cells. {ECO
• Sequence:

  MDPKYFILILFCGHLNNTFFSKTETITTEKQSQPTLFTSSMSQVLANSQNTTGNPLGQPTQFSDTFSGQSISPAK
  VTAGQPTPAVYTSSEKPEAHTSAGQPLAYNTKQPTPIANTSSQQAVFTSARQLPSARTSTTQPPKSFVYTFTQQS
  SSVQIPSRKQITVHNPSTQPTSTVKNSPRSTPGFILDTTSNKQTPQKNNYNSIAAILIGVLLTSMLVAIIIIVLW
  KCLRKPVLNDQNWAGRSPFADGETPDICMDNIRENEISTKRTSIISLTPWKPSKSTLLADDLEIKLFESSENIED
  SNNPKTEKIKDQVNGTSEDSADGSTVGTAVSSSDDADLPPPPPLLDLEGQESNQSDKPTMTIVSPLPNDSTSLPP
  SLDCLNQDCGDHKSEIIQSFPPLDSLNLPLPPVDFMKNQEDSNLEIQCQEFSIPPNSDQDLNESLPPPPAELL

• Structural information:
  • Interpro: IPR033239  
  • STRING: ENSP00000333779
• Other Databases: GeneCards:  EVI2B  Malacards:  EVI2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000035	regulation of stem cell division	IBA	biological process
GO:0045660	positive regulation of neutrophil differentiation	IBA	biological process
GO:0071157	negative regulation of cell cycle arrest	ISS	biological process
GO:0061515	myeloid cell development	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:2000035	regulation of stem cell division	ISS	biological process
GO:0045660	positive regulation of neutrophil differentiation	ISS	biological process
GO:0030854	positive regulation of granulocyte differentiation	ISS	biological process
GO:0030854	positive regulation of granulocyte differentiation	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881