• Gene id: 2123

Gene Summary

• Gene Symbol: EVI2A   Gene   UCSC   Ensembl
• Aliases: EVDA, EVI-2A, EVI2
• Gene name: ecotropic viral integration site 2A
• Alternate names: protein EVI2A, ecotropic viral integration site 2A protein homolog,
• Gene location: 17q11.2 (31321621: 31316409)     Exons: 3     NC_000017.11
• OMIM: 608842

Protein Summary

• Protein general information: P22794  
  • Name: Protein EVI2A (Ecotropic viral integration site 2A protein homolog) (EVI 2A)
  • Length: 236  
  • Mass: 26213
• Sequence:

  MPTDMEHTGHYLHLAFLMTTVFSLSPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNST
  NMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICT
  FLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEE
  GTEKLTNKQIG

• Structural information:
  • Interpro: IPR008608  
  • STRING: ENSP00000247270
• Other Databases: GeneCards:  EVI2A  Malacards:  EVI2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881