• Gene id: 207063

Gene Summary

• Gene Symbol: DHRSX   Gene   UCSC   Ensembl
• Aliases: CXorf11, DHRS5X, DHRS5Y, DHRSXY, DHRSY, SDR46C1, SDR7C6
• Gene name: dehydrogenase/reductase X-linked
• Alternate names: dehydrogenase/reductase SDR family member on chromosome X, dehydrogenase/reductase (SDR family) X chromosome, dehydrogenase/reductase (SDR family) X-linked, dehydrogenase/reductase (SDR family) Y-linked, short chain dehydrogenase/reductase family 46C member 1,
• Gene location: Xp22.33 and Yp11.2 (2500975: 2219505)     Exons: 7     NC_000023.11
• OMIM: 301034

Protein Summary

• Protein general information: Q8N5I4  
  • Name: Dehydrogenase/reductase SDR family member on chromosome X (EC 1.1. . ) (DHRSXY) (Short chain dehydrogenase/reductase family 46C member 1) (Short chain dehydrogenase/reductase family 7C member 6)
  • Length: 330  
  • Mass: 36443
  • Tissue specificity: Widely expressed. Highly expressed in the pancreas. {ECO
• Sequence:

  MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGN
  NDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGL
  NYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRL
  LAAEGSHVTANVVDPGVVNTDVYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGHYLYNEKET
  KSLHVTYNQKLQQQLWSKSCEMTGVLDVTL

• Structural information:
  • Interpro: IPR036291  IPR020904  IPR002347  
  • Prosite: PS00061
  • STRING: ENSP00000334113
• Other Databases: GeneCards:  DHRSX  Malacards:  DHRSX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IBA	cellular component
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)