• Gene id: 205564

Gene Summary

• Gene Symbol: SENP5   Gene   UCSC   Ensembl
• Gene name: SUMO specific peptidase 5
• Alternate names: sentrin-specific protease 5, SUMO1/sentrin specific peptidase 5, SUMO1/sentrin specific protease 5, sentrin/SUMO-specific protease SENP5,
• Gene location: 3q29 (196867855: 196934713)     Exons: 11     NC_000003.12
• Gene summary(Entrez): The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial pr
• OMIM: 612845

Protein Summary

• Protein general information: Q96HI0  
  • Name: Sentrin specific protease 5 (EC 3.4.22. ) (Sentrin/SUMO specific protease SENP5)
  • Length: 755  
  • Mass: 86693
• Sequence:

  MKKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTWIKDEP
  LCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSKTLLRLQAEKLLSSAKNSDHEYCREKNLLKAVTDFPSNSALG
  QANGHRPRTDPQPSDFPMKFNGESQSPGESGTIVVTLNNHKRKGFCYGCCQGPEHHRNGGPLIPKKFQLNQHRRI
  KLSPLMMYEKLSMIRFRYRILRSQHFRTKSKVCKLRKAQRSWVQKVTGDHQETRRENGEGGSCSPFPSPEPKDPS
  CRHQPYFPDMDSSAVVKGTNSHVPDCHTKGSSFLGKELSLDEAFPDQQNGSATNAWDQSSCSSPKWECTELIHDI
  PLPEHRSNTMFISETEREIMTLGQENQTSSVSDDRVKLSVSGADTSVSSVDGPVSQKAVQNENSYQMEEDGSLKQ
  SILSSELLDHPYCKSPLEAPLVCSGLKLENQVGGGKNSQKASPVDDEQLSVCLSGFLDEVMKKYGSLVPLSEKEV
  LGRLKDVFNEDFSNRKPFINREITNYRARHQKCNFRIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVP
  DKVHFFNSFFHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSLITVTLSNRIISFYDSQGIHFKFCVEN
  IRKYLLTEAREKNRPEFLQGWQTAVTKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCE
  CRLMD

• Structural information:
  • Interpro: IPR038765  IPR003653  IPR033465  
  • Prosite: PS50600
  • DIP: 62043
  • STRING: ENSP00000327197
• Other Databases: GeneCards:  SENP5  Malacards:  SENP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016926	protein desumoylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0016926	protein desumoylation	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0019783	ubiquitin-like protein-specific protease activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray