• Gene id: 203260

Gene Summary

• Gene Symbol: CCDC107   Gene   UCSC   Ensembl
• Aliases: PSEC0222
• Gene name: coiled-coil domain containing 107
• Alternate names: coiled-coil domain-containing protein 107,
• Gene location: 9p13.3 (35658289: 35661510)     Exons: 6     NC_000009.12
• Gene summary(Entrez): This gene encodes a membrane protein which contains a coiled-coil domain in the central region. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]
• OMIM: 608718

Protein Summary

• Protein general information: Q8WV48  
  • Name: Coiled coil domain containing protein 107
  • Length: 283  
  • Mass: 30509
• Sequence:

  MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGALYTAA
  VAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTTLAGAQQELLN
  MKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPEDFCLKEDEEEIGDSQA
  WEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQSLFS

• Structural information:
  • Interpro: IPR038779  
  • STRING: ENSP00000414964
• Other Databases: GeneCards:  CCDC107  Malacards:  CCDC107

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881