• Gene id: 202915

Gene Summary

• Gene Symbol: TMEM184A   Gene   UCSC   Ensembl
• Aliases: SDMG1
• Gene name: transmembrane protein 184A
• Alternate names: transmembrane protein 184A, sexually dimorphic, expressed in male gonads 1,
• Gene location: 7p22.3 (1560820: 1542234)     Exons: 11     NC_000007.14

Protein Summary

• Protein general information: Q6ZMB5  
  • Name: Transmembrane protein 184A
  • Length: 413  
  • Mass: 45777
  • Tissue specificity: Expressed in vascular cells (at protein level). {ECO
• Sequence:

  MSNVSGILETAGVPLVSANWPQPSPPPAVPAGPQMDHMGNSSQGAPWLFLTSALARGVSGIFVWTALVLTCHQIY
  LHLRSYTVPQEQRYIIRLLLIVPIYAFDSWLSLLLLGDHQYYVYFDSVRDCYEAFVIYSFLSLCFQYLGGEGAIM
  AEIRGKPIKSSCLYGTCCLRGMTYSIGFLRFCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSGYLYVTL
  IYNASVSLALYALFLFYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILERCGVIPEVETSGGNKLGAGTL
  AAGYQNFIICVEMLFASVALRYAFPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT
  QQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL

• Structural information:
  • Interpro: IPR005178  
  • STRING: ENSP00000297477
• Other Databases: GeneCards:  TMEM184A  Malacards:  TMEM184A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0031901	early endosome membrane	IBA	cellular component
GO:0031901	early endosome membrane	ISS	cellular component
GO:0005768	endosome	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0030659	cytoplasmic vesicle membrane	ISS	cellular component
GO:0030667	secretory granule membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0008201	heparin binding	ISS	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray