• Gene id: 202052

Gene Summary

• Gene Symbol: DNAJC18   Gene   UCSC   Ensembl
• Gene name: DnaJ heat shock protein family (Hsp40) member C18
• Alternate names: dnaJ homolog subfamily C member 18, DnaJ (Hsp40) homolog, subfamily C, member 18,
• Gene location: 5q31.2 (139439524: 139410202)     Exons: 8     NC_000005.10
• OMIM: 0

Protein Summary

• Protein general information: Q9H819  
  • Name: DnaJ homolog subfamily C member 18
  • Length: 358  
  • Mass: 41551
• Sequence:

  MAATLGSGERWTEAYIDAVRRNKYPEDTPPESHDPCGCCNCMKAQKEKKSENEWTQTRQGEGNSTYSEEQLLGVQ
  RIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEYGDEQV
  TFTAPRARPYNYYRDFEADITPEELFNVFFGGHFPTGNIHMFSNVTDDTYYYRRRHRHERTQTQKEEEEEKPQTT
  YSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIE
  KDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLIGLRRGG

• Structural information:
  • Protein Domains: (82..14-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR018253  IPR015399  IPR036869  
  • Prosite: PS00636 PS50076
  • CDD: cd06257
  • STRING: ENSP00000302843
• Other Databases: GeneCards:  DNAJC18  Malacards:  DNAJC18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0071218	cellular response to misfolded protein	IBA	biological process
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0030544	Hsp70 protein binding	IBA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881