• Gene id: 201292

Gene Summary

• Gene Symbol: TRIM65   Gene   UCSC   Ensembl
• Aliases: 4732463G12Rik
• Gene name: tripartite motif containing 65
• Alternate names: tripartite motif-containing protein 65,
• Gene location: 17q25.1 (75897007: 75880378)     Exons: 8     NC_000017.11
• OMIM: 618051

Protein Summary

• Protein general information: Q6PJ69  
  • Name: Tripartite motif containing protein 65
  • Length: 517  
  • Mass: 57353
• Sequence:

  MAAQLLEEKLTCAICLGLYQDPVTLPCGHNFCGACIRDWWDRCGKACPECREPFPDGAELRRNVALSGVLEVVRA
  GPARDPGPDPGPGPDPAARCPRHGRPLELFCRTEGRCVCSVCTVRECRLHERALLDAERLKREAQLRASLEVTQQ
  QATQAEGQLLELRKQSSQIQNSACILASWVSGKFSSLLQALEIQHTTALRSIEVAKTQALAQARDEEQRLRVHLE
  AVARHGCRIRELLEQVDEQTFLQESQLLQPPGPLGPLTPLQWDEDQQLGDLKQLLSRLCGLLLEEGSHPGAPAKP
  VDLAPVEAPGPLAPVPSTVCPLRRKLWQNYRNLTFDPVSANRHFYLSRQDQQVKHCRQSRGPGGPGSFELWQVQC
  AQSFQAGHHYWEVRASDHSVTLGVSYPQLPRCRLGPHTDNIGRGPCSWGLCVQEDSLQAWHNGEAQRLPGVSGRL
  LGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFWLLEGRTLTLCHQPGAVFPLGPQEEVLS

• Structural information:
  • Protein Domains: (313..50-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR003877  IPR000315   IPR018957  IPR001841  IPR013083  IPR017907  
  • Prosite: PS50188 PS50119 PS00518 PS50089
  • CDD: cd00021
  • STRING: ENSP00000269383
• Other Databases: GeneCards:  TRIM65  Malacards:  TRIM65

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010508	positive regulation of autophagy	IBA	biological process
GO:0010508	positive regulation of autophagy	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881