• Gene id: 200407

Gene Summary

• Gene Symbol: CREG2   Gene   UCSC   Ensembl
• Gene name: cellular repressor of E1A stimulated genes 2
• Alternate names: protein CREG2,
• Gene location: 2q11.2 (101387969: 101345549)     Exons: 5     NC_000002.12
• OMIM: 618540

Protein Summary

• Protein general information: Q8IUH2  
  • Name: Protein CREG2 (Cellular repressor of E1A stimulated genes 2)
  • Length: 290  
  • Mass: 32109
  • Tissue specificity: Brain specific mainly in the limbic system and faintly in the spinal cord but not in cerebellum. {ECO
• Sequence:

  MSVRRGRRPARPGTRLSWLLCCSALLSPAAGYVIVSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFP
  ASAHKEDAHLRPRAGAARARPPPAPPGMFSYRREGGQTASAPPGPRLRAATARSLAHASVWGCLATVSTHKKIQG
  LPFGNCLPVSDGPFNNSTGIPFFYMTAKDPVVADLMKNPMASLMLPESEGEFCRKNIVDPEDPRCVQLTLTGQMI
  AVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISREEYFKAVPRKA

• Structural information:
  • Interpro: IPR014631  IPR012349  
  • STRING: ENSP00000315203
• Other Databases: GeneCards:  CREG2  Malacards:  CREG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq