• Gene id: 200010

Gene Summary

• Gene Symbol: SLC5A9   Gene   UCSC   Ensembl
• Aliases: SGLT4
• Gene name: solute carrier family 5 member 9
• Alternate names: sodium/glucose cotransporter 4, Na(+)/glucose cotransporter 4, hSGLT4, solute carrier family 5 (sodium/glucose cotransporter), member 9, solute carrier family 5 (sodium/sugar cotransporter), member 9,
• Gene location: 1p33 (48221112: 48248643)     Exons: 15     NC_000001.11

Protein Summary

• Protein general information: Q2M3M2  
  • Name: Sodium/glucose cotransporter 4 (Na(+)/glucose cotransporter 4) (hSGLT4) (Solute carrier family 5 member 9)
  • Length: 681  
  • Mass: 74073
  • Tissue specificity: Expressed in the small intestine, kidney and liver. {ECO
• Sequence:

  MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIAVGIWSSIRASRGTIGGYFLAGRSMS
  WWPIGASLMSSNVGSGLFIGLAGTGAAGGLAVGGFEWNATWLLLALGWVFVPVYIAAGVVTMPQYLKKRFGGQRI
  QVYMSVLSLILYIFTKISTDIFSGALFIQMALGWNLYLSTGILLVVTAVYTIAGGLMAVIYTDALQTVIMVGGAL
  VLMFLGFQDVGWYPGLEQRYRQAIPNVTVPNTTCHLPRPDAFHILRDPVSGDIPWPGLIFGLTVLATWCWCTDQV
  IVQRSLSAKSLSHAKGGSVLGGYLKILPMFFIVMPGMISRALFPDEVGCVDPDVCQRICGARVGCSNIAYPKLVM
  ALMPVGLRGLMIAVIMAALMSSLTSIFNSSSTLFTIDVWQRFRRKSTEQELMVVGRVFVVFLVVISILWIPIIQS
  SNSGQLFDYIQAVTSYLAPPITALFLLAIFCKRVTEPGAFWGLVFGLGVGLLRMILEFSYPAPACGEVDRRPAVL
  KDFHYLYFAILLCGLTAIVIVIVSLCTTPIPEEQLTRLTWWTRNCPLSELEKEAHESTPEISERPAGECPAGGGA
  AENSSLGQEQPEAPSRSWGKLLWSWFCGLSGTPEQALSPAEKAALEQKLTSIEEEPLWRHVCNINAVLLLAINIF
  LWGYFA

• Structural information:
  • Interpro: IPR038377  IPR001734  IPR018212  
  • Prosite: PS00456 PS50283
  • STRING: ENSP00000236495
• Other Databases: GeneCards:  SLC5A9  Malacards:  SLC5A9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005412	glucose:sodium symporter activity	IBA	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008645	hexose transmembrane transport	TAS	biological process
GO:0005362	low-affinity glucose:sodium symporter activity	TAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:1904659	glucose transmembrane transport	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq