• Gene id: 199953

Gene Summary

• Gene Symbol: TMEM201   Gene   UCSC   Ensembl
• Aliases: Ima1, NET5, SAMP1
• Gene name: transmembrane protein 201
• Alternate names: transmembrane protein 201, RP13-15M17.2, spindle-associated membrane protein 1,
• Gene location: 1p36.22 (9588842: 9614876)     Exons: 14     NC_000001.11

Protein Summary

• Protein general information: Q5SNT2  
  • Name: Transmembrane protein 201 (Spindle associated membrane protein 1)
  • Length: 666  
  • Mass: 72236
• Sequence:

  MEGVSALLARCPTAGLAGGLGVTACAAAGVLLYRIARRMKPTHTMVNCWFCNQDTLVPYGNRNCWDCPHCEQYNG
  FQENGDYNKPIPAQYLEHLNHVVSSAPSLRDPSQPQQWVSSQVLLCKRCNHHQTTKIKQLAAFAPREEGRYDEEV
  EVYRHHLEQMYKLCRPCQAAVEYYIKHQNRQLRALLLSHQFKRREADQTHAQNFSSAVKSPVQVILLRALAFLAC
  AFLLTTALYGASGHFAPGTTVPLALPPGGNGSATPDNGTTPGAEGWRQLLGLLPEHMAEKLCEAWAFGQSHQTGV
  VALGLLTCLLAMLLAGRIRLRRIDAFCTCLWALLLGLHLAEQHLQAASPSWLDTLKFSTTSLCCLVGFTAAVATR
  KATGPRRFRPRRFFPGDSAGLFPTSPSLAIPHPSVGGSPASLFIPSPPSFLPLANQQLFRSPRRTSPSSLPGRLS
  RALSLGTIPSLTRADSGYLFSGSRPPSQVSRSGEFPVSDYFSLLSGSCPSSPLPSPAPSVAGSVASSSGSLRHRR
  PLISPARLNLKGQKLLLFPSPPGEAPTTPSSSDEHSPHNGSLFTMEPPHVPRKPPLQDVKHALDLRSKLERGSAC
  SNRSIKKEDDSSQSSTCVVDTTTRGCSEEAATWRGRFGPSLVRGLLAVSLAANALFTSVFLYQSLR

• Structural information:
  • Interpro: IPR018617  IPR040041  IPR018861  
  • STRING: ENSP00000344503
• Other Databases: GeneCards:  TMEM201  Malacards:  TMEM201

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005521	lamin binding	IBA	molecular function
GO:0030473	nuclear migration along microtubule	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0031965	nuclear membrane	IBA	cellular component
GO:0005639	integral component of nuclear inner membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051015	actin filament binding	IEA	molecular function
GO:0010761	fibroblast migration	IEA	biological process
GO:0007097	nuclear migration	IEA	biological process
GO:0005521	lamin binding	IEA	molecular function
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005637	nuclear inner membrane	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq