Search Result
| Gene id | 1995 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | ELAVL3 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | HUC, HUCL, PLE21 | ||||||||||||||||||||||||||||||||||||||||
| Gene name | ELAV like RNA binding protein 3 | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | ELAV-like protein 3, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 3 (Hu antigen C), ELAV like neuron-specific RNA binding protein 3, Hu antigen C, hu-antigen C, paraneoplastic cerebellar degeneration-associated antigen, paraneoplastic limbic enceph, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
19p13.2 (1528677: 1555567) Exons: 4 NC_000016.10 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
A member of the ELAVL protein family, ELAV-like 3 is a neural-specific RNA-binding protein which contains three RNP-type RNA recognition motifs. The observation that ELAVL3 is one of several Hu antigens (neuronal-specific RNA-binding proteins) recognized |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 603458 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q14576 Name: ELAV like protein 3 (Hu antigen C) (HuC) (Paraneoplastic cerebellar degeneration associated antigen) (Paraneoplastic limbic encephalitis antigen 21) Length: 367 Mass: 39547 Tissue specificity: Brain specific. | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MVTQILGAMESQVGGGPAGPALPNGPLLGTNGATDDSKTNLIVNYLPQNMTQDEFKSLFGSIGDIESCKLVRDKI TGQSLGYGFVNYSDPNDADKAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSGLPKTMSQKEMEQLFSQYGR IITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPLGAAEPITVKFANNPSQKTGQALLTHLYQSSARR YAGPLHHQTQRFRLDNLLNMAYGVKSPLSLIARFSPIAIDGMSGLAGVGLSGGAAGAGWCIFVYNLSPEADESVL WQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGERVLQVSFKTSKQHKA | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: ELAVL3  Malacards: ELAVL3 | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||