• Gene id: 197021

Gene Summary

• Gene Symbol: LCTL   Gene   UCSC   Ensembl
• Aliases: KLG, KLPH
• Gene name: lactase like
• Alternate names: lactase-like protein, KL lactase phlorizin hydrolase, klotho gamma, klotho/lactase-phlorizin hydrolase-related protein,
• Gene location: 15q22.31 (66565997: 66547178)     Exons: 14     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of family 1 glycosidases. Glycosidases are enzymes that hydrolyze glycosidic bonds and are classified into families based on primary amino acid sequence. Most members of family 1 have two conserved glutamic acid residues, which
• OMIM: 602817

Protein Summary

• Protein general information: Q6UWM7  
  • Name: Lactase like protein (Klotho/lactase phlorizin hydrolase related protein)
  • Length: 567  
  • Mass: 65088
• Sequence:

  MKPVWVATLLWMLLLVPRLGAARKGSPEEASFYYGTFPLGFSWGVGSSAYQTEGAWDQDGKGPSIWDVFTHSGKG
  KVLGNETADVACDGYYKVQEDIILLRELHVNHYRFSLSWPRLLPTGIRAEQVNKKGIEFYSDLIDALLSSNITPI
  VTLHHWDLPQLLQVKYGGWQNVSMANYFRDYANLCFEAFGDRVKHWITFSDPRAMAEKGYETGHHAPGLKLRGTG
  LYKAAHHIIKAHAKAWHSYNTTWRSKQQGLVGISLNCDWGEPVDISNPKDLEAAERYLQFCLGWFANPIYAGDYP
  QVMKDYIGRKSAEQGLEMSRLPVFSLQEKSYIKGTSDFLGLGHFTTRYITERNYPSRQGPSYQNDRDLIELVDPN
  WPDLGSKWLYSVPWGFRRLLNFAQTQYGDPPIYVMENGASQKFHCTQLCDEWRIQYLKGYINEMLKAIKDGANIK
  GYTSWSLLDKFEWEKGYSDRYGFYYVEFNDRNKPRYPKASVQYYKKIIIANGFPNPREVESWYLKALETCSINNQ
  MLAAEPLLSHMQMVTEIVVPTVCSLCVLITAVLLMLLLRRQS

• Structural information:
  • Interpro: IPR001360  IPR018120  IPR033132  IPR017853  
  • Prosite: PS00572 PS00653
  • STRING: ENSP00000343490
• Other Databases: GeneCards:  LCTL  Malacards:  LCTL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0008422	beta-glucosidase activity	IBA	molecular function
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0004553	hydrolase activity, hydrolyzing O-glycosyl compounds	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007601	visual perception	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0002089	lens morphogenesis in camera-type eye	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881