• Gene id: 196996

Gene Summary

• Gene Symbol: GRAMD2A   Gene   UCSC   Ensembl
• Aliases: GRAMD2
• Gene name: GRAM domain containing 2A
• Alternate names: GRAM domain-containing protein 2A, GRAM domain containing 2, GRAM domain-containing protein 2,
• Gene location: 15q23 (72197813: 72159805)     Exons: 19     NC_000015.10
• OMIM: 0

Protein Summary

• Protein general information: Q8IUY3  
  • Name: GRAM domain containing protein 2A
  • Length: 354  
  • Mass: 40249
• Sequence:

  MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKCGREGITLNKYNQQYH
  KLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFGKDIKVVIPVVSVQMIKKHKMARLLPNGLAI
  TTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNI
  PCIPPSSVDSTDSFFPSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPR
  STGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR

• Structural information:
  • Protein Domains: (72..13-)
    (/note="GRAM"-)
  • Interpro: IPR004182  IPR011993  IPR042624  
  • STRING: ENSP00000311657
• Other Databases: GeneCards:  GRAMD2A  Malacards:  GRAMD2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031227	intrinsic component of endoplasmic reticulum membrane	IBA	cellular component
GO:0044232	organelle membrane contact site	IBA	cellular component
GO:0061817	endoplasmic reticulum-plasma membrane tethering	IBA	biological process
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IBA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:2001256	regulation of store-operated calcium entry	IBA	biological process
GO:0044232	organelle membrane contact site	IDA	cellular component
GO:0061817	endoplasmic reticulum-plasma membrane tethering	IDA	biological process
GO:0031227	intrinsic component of endoplasmic reticulum membrane	IDA	cellular component
GO:2001256	regulation of store-operated calcium entry	IDA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IDA	molecular function
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)