• Gene id: 196541

Gene Summary

• Gene Symbol: METTL21C   Gene   UCSC   Ensembl
• Aliases: C13orf39
• Gene name: methyltransferase like 21C
• Alternate names: protein-lysine methyltransferase METTL21C, methyltransferase-like protein 21C,
• Gene location: 13q33.1 (102704310: 102678781)     Exons: 5     NC_000013.11
• OMIM: 615259

Protein Summary

• Protein general information: Q5VZV1  
  • Name: Protein lysine methyltransferase METTL21C (EC 2.1.1. ) (Methyltransferase like protein 21C)
  • Length: 264  
  • Mass: 29565
• Sequence:

  MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAG
  KEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQ
  YNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKF
  RFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWD

• Structural information:
  • Interpro: IPR019410  IPR029063  
  • PDB: 4MTL
  • PDBsum: 4MTL
  • STRING: ENSP00000267273
• Other Databases: GeneCards:  METTL21C  Malacards:  METTL21C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018022	peptidyl-lysine methylation	IBA	biological process
GO:0008168	methyltransferase activity	IBA	molecular function
GO:0032259	methylation	IBA	biological process
GO:0016279	protein-lysine N-methyltransferase activity	IBA	molecular function
GO:0016279	protein-lysine N-methyltransferase activity	IDA	molecular function
GO:0006479	protein methylation	IDA	biological process
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0008628	hormone-mediated apoptotic signaling pathway	IEA	biological process
GO:0071549	cellular response to dexamethasone stimulus	IEA	biological process
GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)