• Gene id: 1960

Gene Summary

• Gene Symbol: EGR3   Gene   UCSC   Ensembl
• Aliases: EGR-3, PILOT
• Gene name: early growth response 3
• Alternate names: early growth response protein 3, zinc finger protein pilot,
• Gene location: 8p21.3 (22693479: 22687658)     Exons: 5     NC_000008.11
• Gene summary(Entrez): This gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the t
• OMIM: 602419

Protein Summary

• Protein general information: Q06889  
  • Name: Early growth response protein 3 (EGR 3) (Zinc finger protein pilot)
  • Length: 387  
  • Mass: 42613
• Sequence:

  MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQ
  PAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNC
  GDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPI
  TPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
  GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAEKGGAPSASSAP
  PVSLAPVVTTCA

• Structural information:
  • Interpro: IPR021849  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000318057
• Other Databases: GeneCards:  EGR3  Malacards:  EGR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0007623	circadian rhythm	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0033089	positive regulation of T cell differentiation in thymus	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045586	regulation of gamma-delta T cell differentiation	IEA	biological process
GO:0007422	peripheral nervous system development	IEA	biological process
GO:0007274	neuromuscular synaptic transmission	IEA	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0035767	endothelial cell chemotaxis	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05203	Viral carcinogenesis
hsa05161	Hepatitis B
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)