• Gene id: 195977

Gene Summary

• Gene Symbol: ANTXRL   Gene   UCSC   Ensembl
• Gene name: ANTXR like
• Alternate names: anthrax toxin receptor-like, anthrax toxin receptor like,
• Gene location: 10q11.22 (46286996: 46330418)     Exons: 9     NC_000010.11

Protein Summary

• Protein general information: A6NF34  
  • Name: Anthrax toxin receptor like
  • Length: 631  
  • Mass: 70629
• Sequence:

  MGSHESLGPYFLVFLLLLLLPPPLFRAGSLRYHGPDWRIFHRLALGSRRAHHHHGPGWRQHWRQGQAGHRCQGSF
  DLYFILDKSGSVNNNWIDLYMWVEETVARFQSPNIRMCFITYSTDGQTVLPLTSDKNRIKNGLDQLQKIVPDGHT
  FMQAGFRKAIQQIESFNSGNKVPSMIIAMTDGELVAHAFQDTLREAQKARKLGANVYTLGVADYNLDQITAIADS
  PGHVFAVENGFKALRSTIDALTSKVCLDVTSVEPSSECVGEPYHVVIHGNGFQNLKKRDEVICRFIFNESTIIDE
  KPTSIDNNSMNCPGPKLEKPGEEYSIEVSLNKGKTFFKSNVSITSTTCGIFRNWLYFVPLLLLVPLLLCCVWRLC
  RKQTVKEPPPVQKPEKEPEQEKPPSPPPPPPPPPPPLPPPPPAPVNTCPTVIICCCGCQGVGGMRRIEGNLDTFC
  DLSHASCHQVPWMCCQSRDQGRYLSLALAQSQYAQAPCCPRICFPHSQECLSLPQAPCSPRMCLRHSRECLALKQ
  ARCSPNICLRHSQHSRECLARKQAPCSPRICLRHSPEYFSQAQTLCNPKSCLQPSRECLPLTCSSRCRLPPARCL
  RPPSRMLPLLSPLLRHTAEPPLSLPPSEPNF

• Structural information:
  • Protein Domains: (76..24-)
    (/note="VWFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"-)
  • Interpro: IPR008400  IPR002035  IPR036465  
  • Prosite: PS50234
  • STRING: ENSP00000480615
• Other Databases: GeneCards:  ANTXRL  Malacards:  ANTXRL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:1901998	toxin transport	IBA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq