• Gene id: 1939

Gene Summary

• Gene Symbol: EIF2D   Gene   UCSC   Ensembl
• Aliases: HCA56, LGTN
• Gene name: eukaryotic translation initiation factor 2D
• Alternate names: eukaryotic translation initiation factor 2D, hepatocellular carcinoma-associated antigen 56, ligatin,
• Gene location: 1q32.1 (206612550: 206572483)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene encodes a translation initiation factor involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. This gene was previously referred to as ligatin, but is now known to locali
• OMIM: 613709

Protein Summary

• Protein general information: P41214  
  • Name: Eukaryotic translation initiation factor 2D (eIF2d) (Hepatocellular carcinoma associated antigen 56) (Ligatin)
  • Length: 584  
  • Mass: 64706
• Sequence:

  MFAKAFRVKSNTAIKGSDRRKLRADVTTAFPTLGTDQVSELVPGKEELNIVKLYAHKGDAVTVYVSGGNPILFEL
  EKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMPPAGLPQVQKGDLCAISLVGNRAPVAIGVAA
  MSTAEMLTSGLKGRGFSVLHTYQDHLWRSGNKSSPPSIAPLALDSADLSEEKGSVQMDSTLQGDMRHMTLEGEEE
  NGEVHQAREDKSLSEAPEDTSTRGLNQDSTDSKTLQEQMDELLQQCFLHALKCRVKKADLPLLTSTFLGSHMFSC
  CPEGRQLDIKKSSYKKLSKFLQQMQQEQIIQVKELSKGVESIVAVDWKHPRITSFVIPEPSPTSQTIQEGSREQP
  YHPPDIKPLYCVPASMTLLFQESGHKKGSFLEGSEVRTIVINYAKKNDLVDADNKNLVRLDPILCDCILEKNEQH
  TVMKLPWDSLLTRCLEKLQPAYQVTLPGQEPIVKKGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQ
  QRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK

• Structural information:
  • Protein Domains: (93..17-)
    (/note="PUA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00161-)
    (491..56-)
    (/note="SUI1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00200"-)
  • Interpro: IPR039757  IPR039759  IPR041366  IPR002478  IPR015947   IPR036974  IPR001950  IPR036877  IPR036885  
  • Prosite: PS50890 PS50296
  • CDD: cd11608
  • PDB: 5OA3 5OA9 5W2F
  • PDBsum: 5OA3 5OA9 5W2F
  • STRING: ENSP00000271764
• Other Databases: GeneCards:  EIF2D  Malacards:  EIF2D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001731	formation of translation preinitiation complex	IBA	biological process
GO:0022627	cytosolic small ribosomal subunit	IBA	colocalizes with
GO:0003743	translation initiation factor activity	IBA	molecular function
GO:0003743	translation initiation factor activity	IDA	molecular function
GO:0032790	ribosome disassembly	IDA	biological process
GO:0001731	formation of translation preinitiation complex	IDA	biological process
GO:0022627	cytosolic small ribosomal subunit	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0075522	IRES-dependent viral translational initiation	IDA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0001731	formation of translation preinitiation complex	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0003743	translation initiation factor activity	IEA	molecular function
GO:0006413	translational initiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006886	intracellular protein transport	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)