• Gene id: 1854

Gene Summary

• Gene Symbol: DUT   Gene   UCSC   Ensembl
• Aliases: dUTPase
• Gene name: deoxyuridine triphosphatase
• Alternate names: deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial, dUTP diphosphatase, dUTP nucleotidohydrolase, dUTP pyrophosphatase,
• Gene location: 15q21.1 (48329990: 48343372)     Exons: 9     NC_000015.10
• Gene summary(Entrez): This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the
• OMIM: 601266

Protein Summary

• Protein general information: P33316  
  • Name: Deoxyuridine 5' triphosphate nucleotidohydrolase, mitochondrial (dUTPase) (EC 3.6.1.23) (dUTP pyrophosphatase)
  • Length: 252  
  • Mass: 26563
  • Tissue specificity: Found in a variety of tissues. Isoform 3 expression is constitutive, while isoform 2 expression correlates with the onset of DNA replication (at protein level). Isoform 2 degradation coincides with the cessation of nuclear DNA replicat
• Sequence:

  MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGA
  AGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPME
  KAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERI
  FYPEIEEVQALDDTERGSGGFGSTGKN

• Structural information:
  • Interpro: IPR029054  IPR036157  IPR008181  IPR033704  
  • CDD: cd07557
  • PDB: 1Q5H 1Q5U 2HQU 3ARA 3ARN 3EHW 4MZ5 4MZ6 5H4J
  • PDBsum: 1Q5H 1Q5U 2HQU 3ARA 3ARN 3EHW 4MZ5 4MZ6 5H4J
  • STRING: ENSP00000370376
• Other Databases: GeneCards:  DUT  Malacards:  DUT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	IBA	molecular function
GO:0004170	dUTP diphosphatase activity	IBA	molecular function
GO:0006226	dUMP biosynthetic process	IBA	biological process
GO:0046081	dUTP catabolic process	IBA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004170	dUTP diphosphatase activity	IEA	molecular function
GO:0006226	dUMP biosynthetic process	IEA	biological process
GO:0046081	dUTP catabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0009117	nucleotide metabolic process	IEA	biological process
GO:0004170	dUTP diphosphatase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0004170	dUTP diphosphatase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0015949	nucleobase-containing small molecule interconversion	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006226	dUMP biosynthetic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)