Search Result
| Gene id | 1827 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | RCAN1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | ADAPT78, CSP1, DSC1, DSCR1, MCIP1, RCN1 | ||||||||||||||||||||||||||||||||||||||||
| Gene name | regulator of calcineurin 1 | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | calcipressin-1, Down syndrome candidate region 1, Down syndrome critical region gene 1, calcium and oxidant-inducible mRNA, modulatory calcineurin-interacting protein 1, myocyte-enriched calcineurin-interacting protein 1, near DSCR proline-rich protein, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
21q22.12 (34615122: 34516441) Exons: 9 NC_000021.9 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotyp |
||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | P53805 Name: Calcipressin 1 (Adapt78) (Down syndrome critical region protein 1) (Myocyte enriched calcineurin interacting protein 1) (MCIP1) (Regulator of calcineurin 1) Length: 252 Mass: 28079 Tissue specificity: Highly expressed heart, brain and skeletal muscle. Also expressed in all other tissues. | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDP RVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSH LAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEE EEMERMRRPKPKIIQTRRPEYTPIHLS | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: RCAN1  Malacards: RCAN1 | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||