• Gene id: 1808

Gene Summary

• Gene Symbol: DPYSL2   Gene   UCSC   Ensembl
• Aliases: CRMP-2, CRMP2, DHPRP2, DRP-2, DRP2, N2A3, ULIP-2, ULIP2
• Gene name: dihydropyrimidinase like 2
• Alternate names: dihydropyrimidinase-related protein 2, collapsin response mediator protein hCRMP-2, unc-33-like phosphoprotein 2,
• Gene location: 8p21.2 (31230861: 31221812)     Exons: 5     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and i
• OMIM: 602463

Protein Summary

• Protein general information: Q16555  
  • Name: Dihydropyrimidinase related protein 2 (DRP 2) (Collapsin response mediator protein 2) (CRMP 2) (N2A3) (Unc 33 like phosphoprotein 2) (ULIP 2)
  • Length: 572  
  • Mass: 62294
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTR
  FQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQE
  EMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVL
  SRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA
  FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKM
  DENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQG
  KIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAK
  QQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG

• Structural information:
  • Interpro: IPR006680  IPR030615  IPR011778  IPR011059  IPR032466  
  • CDD: cd01314
  • PDB: 2GSE 2VM8 5LXX 5MKV 5MLE 5X1A 5X1C 5X1D 5YZ5 5YZA 5YZB 6JV9 6JVB
  • PDBsum: 2GSE 2VM8 5LXX 5MKV 5MLE 5X1A 5X1C 5X1D 5YZ5 5YZA 5YZB 6JV9 6JVB
  • STRING: ENSP00000309539
• Other Databases: GeneCards:  DPYSL2  Malacards:  DPYSL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016812	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides	IBA	molecular function
GO:0006208	pyrimidine nucleobase catabolic process	IBA	NOT|biological process
GO:0005829	cytosol	IBA	cellular component
GO:0004157	dihydropyrimidinase activity	IBA	NOT|molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	IDA	colocalizes with
GO:0005874	microtubule	IDA	colocalizes with
GO:0007010	cytoskeleton organization	ISS	biological process
GO:0006897	endocytosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007411	axon guidance	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0030516	regulation of axon extension	IEA	biological process
GO:0045664	regulation of neuron differentiation	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004157	dihydropyrimidinase activity	TAS	molecular function
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray