• Gene id: 1780

Gene Summary

• Gene Symbol: DYNC1I1   Gene   UCSC   Ensembl
• Aliases: DNCI1, DNCIC1
• Gene name: dynein cytoplasmic 1 intermediate chain 1
• Alternate names: cytoplasmic dynein 1 intermediate chain 1, DH IC-1, cytoplasmic dynein intermediate chain 1, dynein intermediate chain 1, cytosolic, dynein, cytoplasmic, intermediate polypeptide 1,
• Gene location: 7q21.3 (52386976: 52377664)     Exons: 10     NC_000012.12
• OMIM: 603772

Protein Summary

• Protein general information: O14576  
  • Name: Cytoplasmic dynein 1 intermediate chain 1 (Cytoplasmic dynein intermediate chain 1) (Dynein intermediate chain 1, cytosolic) (DH IC 1)
  • Length: 645  
  • Mass: 72955
• Sequence:

  MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLV
  QPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGV
  SKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQIL
  HSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYP
  ELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRR
  TPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSLDMLSTPQESMELVYNKSKPVAVTGMAFPTG
  DVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPL
  YSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEG
  RIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA

• Structural information:
  • Interpro: IPR025956  IPR015943  IPR001680  IPR017986  IPR036322  
  • Prosite: PS50294
  • STRING: ENSP00000320130
• Other Databases: GeneCards:  DYNC1I1  Malacards:  DYNC1I1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0008017	microtubule binding	ISS	molecular function
GO:0003777	microtubule motor activity	ISS	molecular function
GO:0047496	vesicle transport along microtubule	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0045503	dynein light chain binding	IBA	molecular function
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005868	cytoplasmic dynein complex	IBA	cellular component
GO:2000582	positive regulation of ATP-dependent microtubule motor activity, plus-end-directed	IBA	biological process
GO:0045504	dynein heavy chain binding	IBA	molecular function
GO:0010970	transport along microtubule	IBA	biological process
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005868	cytoplasmic dynein complex	IEA	cellular component
GO:0007018	microtubule-based movement	IEA	biological process
GO:0003774	motor activity	IEA	molecular function
GO:0000776	kinetochore	IEA	cellular component
GO:0030286	dynein complex	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0003774	motor activity	TAS	molecular function
GO:0005868	cytoplasmic dynein complex	TAS	cellular component
GO:0030507	spectrin binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045503	dynein light chain binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0047496	vesicle transport along microtubule	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04145	Phagosome
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)