• Gene id: 1776

Gene Summary

• Gene Symbol: DNASE1L3   Gene   UCSC   Ensembl
• Aliases: DHP2, DNAS1L3, LSD, SLEB16
• Gene name: deoxyribonuclease 1 like 3
• Alternate names: deoxyribonuclease gamma, DNase I homolog protein 2, DNase I homolog protein DHP2, DNase I-like 3, DNase gamma, LS-DNase, Liver and spleen DNase, deoxyribonuclease I-like 3, deoxyribonuclease I-like III,
• Gene location: 3p14.3 (58211002: 58192256)     Exons: 8     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the deoxyribonuclease I family. The encoded protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Mutations in this gene are a cause of systemic lupus erythematosus-16. Alterna
• OMIM: 173410

Protein Summary

• Protein general information: Q13609  
  • Name: Deoxyribonuclease gamma (DNase gamma) (EC 3.1.21. ) (DNase I homolog protein DHP2) (Deoxyribonuclease I like 3) (DNase I like 3) (Liver and spleen DNase) (LS DNase) (LSD)
  • Length: 305  
  • Mass: 35504
  • Tissue specificity: Liver and spleen.
• Sequence:

  MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKL
  NRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFV
  IIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTV
  KKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKT
  KSKRS

• Structural information:
  • Interpro: IPR018057  IPR016202  IPR033125  IPR036691  IPR005135  
  • Prosite: PS00919 PS00918
  • STRING: ENSP00000378053
• Other Databases: GeneCards:  DNASE1L3  Malacards:  DNASE1L3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000737	DNA catabolic process, endonucleolytic	IBA	biological process
GO:0003677	DNA binding	IBA	molecular function
GO:0004530	deoxyribonuclease I activity	IBA	molecular function
GO:0004536	deoxyribonuclease activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006308	DNA catabolic process	IBA	biological process
GO:0010623	programmed cell death involved in cell development	IBA	biological process
GO:0006309	apoptotic DNA fragmentation	IBA	biological process
GO:0006309	apoptotic DNA fragmentation	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070948	regulation of neutrophil mediated cytotoxicity	ISS	biological process
GO:0002673	regulation of acute inflammatory response	ISS	biological process
GO:0002283	neutrophil activation involved in immune response	ISS	biological process
GO:0004536	deoxyribonuclease activity	IEA	molecular function
GO:0006308	DNA catabolic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0004518	nuclease activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0012501	programmed cell death	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	TAS	molecular function
GO:0004536	deoxyribonuclease activity	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0006259	DNA metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006309	apoptotic DNA fragmentation	IEA	biological process
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004520	endodeoxyribonuclease activity	IEA	molecular function
GO:0070948	regulation of neutrophil mediated cytotoxicity	IEA	biological process
GO:0010623	programmed cell death involved in cell development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0002673	regulation of acute inflammatory response	IEA	biological process
GO:0002283	neutrophil activation involved in immune response	IEA	biological process
GO:0000737	DNA catabolic process, endonucleolytic	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881