• Gene id: 171392

Gene Summary

• Gene Symbol: ZNF675   Gene   UCSC   Ensembl
• Aliases: TBZF, TIZ
• Gene name: zinc finger protein 675
• Alternate names: zinc finger protein 675, TRAF6 inhibitory zinc finger, TRAF6-binding zinc finger protein, TRAF6-inhibitory zinc finger protein,
• Gene location: 19p12 (23687211: 23652800)     Exons: 4     NC_000019.10
• OMIM: 609686

Protein Summary

• Protein general information: Q8TD23  
  • Name: Zinc finger protein 675 (TRAF6 binding zinc finger protein) (TRAF6 inhibitory zinc finger protein)
  • Length: 568  
  • Mass: 66299
• Sequence:

  MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPLTVKRHEMVNEPP
  VMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVDECKLHKGGYNGLNQCLPTMQSKMFQCDKYV
  KVFNKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYTKVNFCKCEECEKAVNQSSKLTKHKRIYTCE
  KLYKCQECDRTFNQFSNLTEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLT
  THKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKNIHTGEQPYKCEECGK
  AFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKKLHTGKK
  PYKCEECGKAFIQSSKLTEHKKIHSGEIPYKCEECGKAFKHSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTE
  HKIIHTGEKPYKCERCDKAFNQSANLTKHKKIHTGEKLQNWNV

• Structural information:
  • Protein Domains: (4..7-)
    (/note="KRAB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
  • Interpro: IPR001909  IPR036051  IPR036236  IPR013087  
  • Prosite: PS50805 PS00028 PS50157
  • CDD: cd07765
  • STRING: ENSP00000352836
• Other Databases: GeneCards:  ZNF675  Malacards:  ZNF675

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0043508	negative regulation of JUN kinase activity	IDA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:2000660	negative regulation of interleukin-1-mediated signaling pathway	IDA	biological process
GO:2000678	negative regulation of transcription regulatory region DNA binding	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0046329	negative regulation of JNK cascade	IDA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IDA	biological process
GO:0019221	cytokine-mediated signaling pathway	IDA	biological process
GO:0045453	bone resorption	TAS	biological process
GO:0003677	DNA binding	NAS	molecular function
GO:0008270	zinc ion binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq