• Gene id: 169200

Gene Summary

• Gene Symbol: TMEM64   Gene   UCSC   Ensembl
• Gene name: transmembrane protein 64
• Alternate names: transmembrane protein 64,
• Gene location: 8q21.3 (90646082: 90621994)     Exons: 3     NC_000008.11
• OMIM: 0

Protein Summary

• Protein general information: Q6YI46  
  • Name: Transmembrane protein 64
  • Length: 380  
  • Mass: 39665
• Sequence:

  MRSPGGILLQALPRLLQHAALPGLAELPARWALPRGAGGDGPADRLPRGGGASAAAAAAAASGALLGAYLERHGP
  PEASELPEPGGALAGGPGSGGGGVVVGVAEVRNWRCCCLGSTCWCRSLVLVCVLAALCFASLALVRRYLHHLLLW
  VESLDSLLGVLLFVVGFIVVSFPCGWGYIVLNVAAGYLYGFVLGMGLMMVGVLIGTFIAHVVCKRLLTAWVAARI
  QSSEKLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLMASSVGLLPTQLLNSYLGTTLRTME
  DVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSSLVKGNQPNTSGSSFYNKRTLTFSGG
  GINVV

• Structural information:
  • Interpro: IPR032816  
  • STRING: ENSP00000414786
• Other Databases: GeneCards:  TMEM64  Malacards:  TMEM64

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045600	positive regulation of fat cell differentiation	ISS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0045668	negative regulation of osteoblast differentiation	ISS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0051480	regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0045780	positive regulation of bone resorption	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0043462	regulation of ATPase activity	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)