• Gene id: 166824

Gene Summary

• Gene Symbol: RASSF6   Gene   UCSC   Ensembl
• Gene name: Ras association domain family member 6
• Alternate names: ras association domain-containing protein 6, Ras association (RalGDS/AF-6) domain family 6, Ras association (RalGDS/AF-6) domain family member 6, putative RAS binding protein,
• Gene location: 4q13.3 (73620630: 73571549)     Exons: 9     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the Ras-association domain family (RASSF). Members of this family form the core of a highly conserved tumor suppressor network, the Salvador-Warts-Hippo (SWH) pathway. The protein encoded by this gene is a Ras effector protei
• OMIM: 612620

Protein Summary

• Protein general information: Q6ZTQ3  
  • Name: Ras association domain containing protein 6
  • Length: 369  
  • Mass: 43384
  • Tissue specificity: Highest expression in thymus, kidney and placenta. Also detected in colon, small intestine and lung. Tends to be down-regulated in 30-60% of tumors derived from breast, colon, kidney liver, rectum, pancreas, stomach and the thyroid gla
• Sequence:

  MLWEETGAAPAPARASDLPYRISSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLH
  ILYGETEDGKLIVEGMLDIFWGVKRPIQLKIQDEKPFSSFTSMKSSDVFSSKGMTRWGEFDDLYRISELDRTQIP
  MSEKRNSQEDYLSYHSNTLKPHAKDEPDSPVLYRTMSEAALVRKRMKPLMMDRKERQKNRASINGHFYNHETSIF
  IPAFESETKVRVNSNMRTEEVIKQLLQKFKIENSPQDFALHIIFATGEQRRLKKTDIPLLQRLLQGPSEKNARIF
  LMDKDAEEISSDVAQYINFHFSLLESILQRLNEEEKREIQRIVTKFNKEKAIILKCLQNKLVIKTETTV

• Structural information:
  • Protein Domains: (218..30-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166-)
    (313..36-)
    (/note="SARAH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00310"-)
  • Interpro: IPR033614  IPR000159  IPR033625  IPR011524  IPR029071  
  • Prosite: PS50200 PS50951
  • STRING: ENSP00000340578
• Other Databases: GeneCards:  RASSF6  Malacards:  RASSF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04390	Hippo signaling pathway
hsa04392	Hippo signaling pathway - multiple species

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881