• Gene id: 1666

Gene Summary

• Gene Symbol: DECR1   Gene   UCSC   Ensembl
• Aliases: DECR, NADPH, SDR18C1
• Gene name: 2,4-dienoyl-CoA reductase 1
• Alternate names: 2,4-dienoyl-CoA reductase, mitochondrial, 2,4-dienoyl-CoA reductase 1, mitochondrial, 4-enoyl-CoA reductase, short chain dehydrogenase/reductase family 18C member 1,
• Gene location: 8q21.3 (90001351: 90053632)     Exons: 13     NC_000008.11
• Gene summary(Entrez): This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq, Jul 2008]
• OMIM: 222745

Protein Summary

• Protein general information: Q16698  
  • Name: 2,4 dienoyl CoA reductase, mitochondrial (EC 1.3.1.34) (2,4 dienoyl CoA reductase [NADPH]) (4 enoyl CoA reductase [NADPH]) (Short chain dehydrogenase/reductase family 18C member 1)
  • Length: 335  
  • Mass: 36,068
• Sequence:

  MKLPARVFFTLGSRLPCGLAPRRFFSYGTKILYQNTEALQSKFFSPLQKAMLPPNSFQGKVAFITGGGTGLGKGM
  TTLLSSLGAQCVIASRKMDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFI
  SPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLA
  AEWGKYGMRFNVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFD
  GGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS

• Structural information:
  • Interpro: IPR036291  IPR002347  
  • PDB: 1W6U 1W73 1W8D
  • PDBsum: 1W6U 1W73 1W8D
  • STRING: ENSP00000220764
• Other Databases: GeneCards:  DECR1  Malacards:  DECR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	NAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006635	fatty acid beta-oxidation	IDA	biological process
GO:0006635	fatty acid beta-oxidation	TAS	biological process
GO:0008670	2,4-dienoyl-CoA reductase (NADPH) activity	IDA	molecular function
GO:0016651	oxidoreductase activity, acting on NAD(P)H	TAS	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070402	NADPH binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	NAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006635	fatty acid beta-oxidation	IDA	biological process
GO:0006635	fatty acid beta-oxidation	TAS	biological process
GO:0008670	2,4-dienoyl-CoA reductase (NADPH) activity	IEA	molecular function
GO:0008670	2,4-dienoyl-CoA reductase (NADPH) activity	IDA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016651	oxidoreductase activity, acting on NAD(P)H	TAS	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070402	NADPH binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	NAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006635	fatty acid beta-oxidation	IDA	biological process
GO:0006635	fatty acid beta-oxidation	TAS	biological process
GO:0008670	2,4-dienoyl-CoA reductase (NADPH) activity	IDA	molecular function
GO:0016651	oxidoreductase activity, acting on NAD(P)H	TAS	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070402	NADPH binding	IDA	molecular function

Diseases

Associated diseases	References
Albuminuria	GAD: 17903292
Bone diseases	GAD: 17903296
Parkinson disease	GAD: 18568448
Male factor infertility	MIK: 15482762
Semen quality	MIK: 15482762
Morphologically abnormal spermatozoa	MIK: 15897967
Morphologically abnormal spermatozoa	MIK: 15897967
Albuminuria	GAD: 17903292
Morphologically abnormal spermatozoa	MIK: 15897967
Male infertility	MIK: 15482762
Semen quality	MIK: 15482762
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15482762	Male infertility, semen quality			17 (11 infertile men, 6 healthy controls)	Male infertility
15897967	Male infertility, morphologically abnormal spermatozoa			13 (7 men undergoing infertility screening, 6 donors)	Male infertility	NADPH
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)