Search Result
| Gene id | 165721 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | DNAJB8 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CT156, DJ6 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | DnaJ heat shock protein family (Hsp40) member B8 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | dnaJ homolog subfamily B member 8, DnaJ (Hsp40) homolog, subfamily B, member 8, testicular tissue protein Li 56, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
3q21.3 (38564813: 38488096) Exons: 17 NC_000015.10 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene belongs to the DNAJ/HSP40 family of proteins that regulate chaperone activity. This family member suppresses aggregation and toxicity of polyglutamine proteins, and the C-terminal tail is essential for this activity. It ha |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 611337 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8NHS0 Name: DnaJ homolog subfamily B member 8 Length: 232 Mass: 25686 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKRSLYDRAGCDSWRA GGGASTPYHSPFDTGYTFRNPEDIFREFFGGLDPFSFEFWDSPFNSDRGGRGHGLRGAFSAGFGEFPAFMEAFSS FNMLGCSGGSHTTFSSTSFGGSSSGSSGFKSVMSSTEMINGHKVTTKRIVENGQERVEVEEDGQLKSVTVNGKEQ LKWMDSK | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: DNAJB8  Malacards: DNAJB8 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||