• Gene id: 1650

Gene Summary

• Gene Symbol: DDOST   Gene   UCSC   Ensembl
• Aliases: AGER1, CDG1R, GATD6, OKSWcl45, OST, OST48, WBP1
• Gene name: dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit
• Alternate names: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit, advanced glycation end-product receptor 1, advanced glycation endproduct receptor 1, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit (non-catalytic), dolichy,
• Gene location: 1p36.12 (20661368: 20651776)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene encodes a component of the oligosaccharyltransferase complex which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues on nascent polypeptides in the lumen of the rough endoplasmic reticulum. The protein complex co-pur
• OMIM: 602202

Protein Summary

• Protein general information: P39656  
  • Name: Dolichyl diphosphooligosaccharide protein glycosyltransferase 48 kDa subunit (DDOST 48 kDa subunit) (Oligosaccharyl transferase 48 kDa subunit)
  • Length: 456  
  • Mass: 50801
• Sequence:

  MGYFRCARAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETHSLFFRSLKDRGFELT
  FKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD
  EEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFF
  PDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVF
  KEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKY
  SVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMLGLFIFSIVFLHMK
  EKEKSD

• Structural information:
  • Interpro: IPR005013  
  • STRING: ENSP00000399457
• Other Databases: GeneCards:  DDOST  Malacards:  DDOST

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008250	oligosaccharyltransferase complex	IDA	is active in
GO:0008047	enzyme activator activity	IMP	molecular function
GO:0006487	protein N-linked glycosylation	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0018279	protein N-linked glycosylation via asparagine	IC	biological process
GO:0018279	protein N-linked glycosylation via asparagine	IBA	biological process
GO:0008250	oligosaccharyltransferase complex	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0008250	oligosaccharyltransferase complex	IDA	cellular component
GO:0042110	T cell activation	IDA	biological process
GO:0006487	protein N-linked glycosylation	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0034097	response to cytokine	IDA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0008250	oligosaccharyltransferase complex	ISS	cellular component
GO:0006486	protein glycosylation	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04141	Protein processing in endoplasmic reticulum
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Congenital disorders of glycosylation type I	KEGG:H00118
Congenital disorders of glycosylation type I	KEGG:H00118
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq