• Gene id: 164284

Gene Summary

• Gene Symbol: APCDD1L   Gene   UCSC   Ensembl
• Gene name: APC down-regulated 1 like
• Alternate names: protein APCDD1-like, adenomatosis polyposis coli down-regulated 1 like,
• Gene location: 20q13.32 (58515398: 58459100)     Exons: 5     NC_000020.11

Protein Summary

• Protein general information: Q8NCL9  
  • Name: Protein APCDD1 like (Adenomatosis polyposis coli down regulated 1 protein like)
  • Length: 501  
  • Mass: 55635
• Sequence:

  MPAAMLPYACVLVLLGAHTAPAAGEAGGSCLRWEPHCQQPLPDRVPSTAILPPRLNGPWISTGCEVRPGPEFLTR
  AYTFYPSRLFRAHQFYYEDPFCGEPAHSLLVKGKVRLRRASWVTRGATEADYHLHKVGIVFHSRRALVDVTGRLN
  QTRAGRDCARRLPPARAWLPGALYELRSARAQGDCLEALGLTMHELSLVRVQRRLQPQPRASPRLVEELYLGDIH
  TDPAERRHYRPTGYQRPLQSALHHVQPCPACGLIARSDVHHPPVLPPPLALPLHLGGWWVSSGCEVRPAVLFLTR
  LFTFHGHSRSWEGYYHHFSDPACRQPTFTVYAAGRYTRGTPSTRVRGGTELVFEVTRAHVTPMDQVTTAMLNFSE
  PSSCGGAGAWSMGTERDVTATNGCLPLGIRLPHVEYELFKMEQDPLGQSLLFIGQRPTDGSSPDTPEKRPTSYQA
  PLVLCHGEAPDFSRPPQHRPSLQKHPSTGGLHIAPFPLLPLVLGLAFLHWL

• Structural information:
  • Interpro: IPR042425  IPR029405  
  • STRING: ENSP00000360191
• Other Databases: GeneCards:  APCDD1L  Malacards:  APCDD1L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IEA	cellular component
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq