• Gene id: 1638

Gene Summary

• Gene Symbol: DCT   Gene   UCSC   Ensembl
• Aliases: TRP-2, TYRP2
• Gene name: dopachrome tautomerase
• Alternate names: L-dopachrome tautomerase, DT, L-dopachrome Delta-isomerase, L-dopachrome isomerase, TRP2, dopachrome delta-isomerase, dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2), tyrosinase related protein-2, tyrosine-related protein 2,
• Gene location: 13q32.1 (94549405: 94436810)     Exons: 14     NC_000013.11

Protein Summary

• Protein general information: P40126  
  • Name: L dopachrome tautomerase (DCT) (DT) (EC 5.3.3.12) (L dopachrome Delta isomerase) (Tyrosinase related protein 2) (TRP 2) (TRP2)
  • Length: 519  
  • Mass: 59145
• Sequence:

  MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPY
  ILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKK
  RVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLL
  CLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCN
  GTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSF
  LNGTNALPHSAANDPIFVVLHSFTDAIFDEWMKRFNPPADAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTSDQ
  LGYSYAIDLPVSVEETPGWPTTLLVVMGTLVALVGLFVLLAFLQYRRLRKGYTPLMETHLSSKRYTEEA

• Structural information:
  • Interpro: IPR002227  IPR008922  
  • Prosite: PS00497 PS00498
  • PDB: 4HX1
  • PDBsum: 4HX1
  • STRING: ENSP00000392762
• Other Databases: GeneCards:  DCT  Malacards:  DCT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004167	dopachrome isomerase activity	IBA	molecular function
GO:0006583	melanin biosynthetic process from tyrosine	IBA	biological process
GO:0021847	ventricular zone neuroblast division	IBA	biological process
GO:0042470	melanosome	IBA	cellular component
GO:0002052	positive regulation of neuroblast proliferation	IBA	biological process
GO:0048066	developmental pigmentation	IBA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0042438	melanin biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005507	copper ion binding	TAS	molecular function
GO:0006583	melanin biosynthetic process from tyrosine	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0008544	epidermis development	TAS	biological process
GO:0004167	dopachrome isomerase activity	IEA	molecular function
GO:0033162	melanosome membrane	TAS	cellular component
GO:0042438	melanin biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048066	developmental pigmentation	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0002052	positive regulation of neuroblast proliferation	IEA	biological process
GO:0048468	cell development	IEA	biological process
GO:0043473	pigmentation	IEA	biological process
GO:0042470	melanosome	IEA	cellular component
GO:0042438	melanin biosynthetic process	IEA	biological process
GO:0021847	ventricular zone neuroblast division	IEA	biological process
GO:0006583	melanin biosynthetic process from tyrosine	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004167	dopachrome isomerase activity	IEA	molecular function
GO:0033162	melanosome membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0042438	melanin biosynthetic process	IEA	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0006583	melanin biosynthetic process from tyrosine	ISS	biological process
GO:0042470	melanosome	ISS	cellular component
GO:0004167	dopachrome isomerase activity	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04916	Melanogenesis
hsa00350	Tyrosine metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R