• Gene id: 162515

Gene Summary

• Gene Symbol: SLC16A11   Gene   UCSC   Ensembl
• Aliases: MCT 11, MCT11
• Gene name: solute carrier family 16 member 11
• Alternate names: monocarboxylate transporter 11, monocarboxylic acid transporter 11, solute carrier family 16 (monocarboxylic acid transporters), member 11,
• Gene location: 17p13.1 (7044410: 7041620)     Exons: 5     NC_000017.11
• OMIM: 180069

Protein Summary

• Protein general information: Q8NCK7  
  • Name: Monocarboxylate transporter 11 (MCT 11) (Solute carrier family 16 member 11)
  • Length: 471  
  • Mass: 47791
  • Tissue specificity: Expressed in liver, salivary gland and thyroid. {ECO
• Sequence:

  MPAPQRKHRRGGFSHRCFPTPQTAMTPQPAGPPDGGWGWVVAAAAFAINGLSYGLLRSLGLAFPDLAEHFDRSAQ
  DTAWISALALAVQQAASPVGSALSTRWGARPVVMVGGVLASLGFVFSAFASDLLHLYLGLGLLAGFGWALVFAPA
  LGTLSRYFSRRRVLAVGLALTGNGASSLLLAPALQLLLDTFGWRGALLLLGAITLHLTPCGALLLPLVLPGDPPA
  PPRSPLAALGLSLFTRRAFSIFALGTALVGGGYFVPYVHLAPHALDRGLGGYGAALVVAVAAMGDAGARLVCGWL
  ADQGWVPLPRLLAVFGALTGLGLWVVGLVPVVGGEESWGGPLLAAAVAYGLSAGSYAPLVFGVLPGLVGVGGVVQ
  ATGLVMMLMSLGGLLGPPLSGFLRDETGDFTASFLLSGSLILSGSFIYIGLPRALPSCGPASPPATPPPETGELL
  PAPQAVLLSPGGPGSTLDTTC

• Structural information:
  • Interpro: IPR030769  IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000310490
• Other Databases: GeneCards:  SLC16A11  Malacards:  SLC16A11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008028	monocarboxylic acid transmembrane transporter activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0006629	lipid metabolic process	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0050833	pyruvate transmembrane transporter activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1901475	pyruvate transmembrane transport	IEA	biological process
GO:0015718	monocarboxylic acid transport	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R